Protein Info for BWI76_RS18850 in Klebsiella michiganensis M5al

Annotation: iron-sulfur cluster assembly scaffold protein NifU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR02000: Fe-S cluster assembly protein NifU" amino acids 1 to 274 (274 residues), 489.6 bits, see alignment E=1.6e-151 PF01592: NifU_N" amino acids 4 to 125 (122 residues), 157.6 bits, see alignment E=2.5e-50 PF04324: Fer2_BFD" amino acids 135 to 184 (50 residues), 64.5 bits, see alignment 1.3e-21 PF01106: NifU" amino acids 210 to 271 (62 residues), 63.8 bits, see alignment E=2e-21

Best Hits

Swiss-Prot: 100% identical to NIFU_KLEPN: Nitrogen fixation protein NifU (nifU) from Klebsiella pneumoniae

KEGG orthology group: K13819, NifU-like protein (inferred from 90% identity to kpe:KPK_1706)

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein NifU" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6C1 at UniProt or InterPro

Protein Sequence (274 amino acids)

>BWI76_RS18850 iron-sulfur cluster assembly scaffold protein NifU (Klebsiella michiganensis M5al)
MWNYSEKVKDHFFNPRNARVVDNANAVGDVGSLSCGDALRLMLRVDPQSEIIEEAGFQTF
GCGSAIASSSALTELIIGHTLAEAGQITNQQIADYLDGLPPEKMHCSVMGQEALRAAIAN
FRGESLEEEHDEGKLICKCFGVDEGHIRRAVQNNGLTTLAEVINYTKAGGGCTSCHEKIE
LALAEILAQQPQTTPAVASGKDPHWQSVVDTIAELRPHIQADGGDMALLSVTNHQVTVSL
SGSCSGCMMTDMTLAWLQQKLMERTGCYMEVVAA