Protein Info for BWI76_RS18840 in Klebsiella michiganensis M5al

Annotation: nitrogenase iron-molybdenum cofactor biosynthesis protein NifN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR01285: nitrogenase molybdenum-iron cofactor biosynthesis protein NifN" amino acids 2 to 432 (431 residues), 708 bits, see alignment E=2.3e-217 PF00148: Oxidored_nitro" amino acids 20 to 430 (411 residues), 318.8 bits, see alignment E=2.6e-99

Best Hits

Swiss-Prot: 100% identical to NIFN_KLEPN: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifN (nifN) from Klebsiella pneumoniae

KEGG orthology group: K02592, nitrogenase molybdenum-iron protein NifN (inferred from 85% identity to kva:Kvar_1597)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifN" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6B3 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BWI76_RS18840 nitrogenase iron-molybdenum cofactor biosynthesis protein NifN (Klebsiella michiganensis M5al)
MADIFRTDKPLAVSPIKTGQPLGAILASLGIEHSIPLVHGAQGCSAFAKVFFIQHFHDPV
PLQSTAMDPTSTIMGADGNIFTALDTLCQRNNPQAIVLLSTGLSEAQGSDISRVVRQFRE
EYPRHKGVAILTVNTPDFYGSMENGFSAVLESVIEQWVPPAPRPAQRNRRVNLLVSHLCS
PGDIEWLRRCVEAFGLQPIILPDLAQSMDGHLAQGDFSPLTQGGTPLRQIEQMGQSLCSF
AIGVSLHRASSLLAPRCRGEVIALPHLMTLERCDAFIHQLAKISGRAVPEWLERQRGQLQ
DAMIDCHMWLQGQRMAIAAEGDLLAAWCDFANSQGMQPGPLVAPTGHPSLRQLPVERVVP
GDLEDLQTLLCAHPADLLVANSHARDLAEQFALPLVRAGFPLFDKLGEFRRVRQGYSGMR
DTLFELANLIRERHHHLAHYRSPLRQNPESSLSTGGAYAAD