Protein Info for BWI76_RS18805 in Klebsiella michiganensis M5al

Annotation: pyruvate:ferredoxin (flavodoxin) oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02176: pyruvate:ferredoxin (flavodoxin) oxidoreductase
  • amino acids 5 to 1168 (1164 residues), 1862.6 bits, E=0
• PF01855: POR_N
  • amino acids 22 to 247 (226 residues), 264.1 bits, E=4.9e-82
• PF17147: PFOR_II
  • amino acids 269 to 374 (106 residues), 61.6 bits, E=3.3e-20
• PF01558: POR
  • amino acids 426 to 609 (184 residues), 117 bits, E=4.3e-37
• PF10371: EKR
  • amino acids 627 to 680 (54 residues), 77 bits, 3.2e-25
• PF00037: Fer4
  • amino acids 684 to 707 (24 residues), 21.3 bits, see alignment (E = 7.2e-08)
• PF13237: Fer4_10
  • amino acids 687 to 756 (70 residues), 27.7 bits, 8.1e-10
• PF12838: Fer4_7
  • amino acids 691 to 757 (67 residues), 33.4 bits, 2e-11
• PF02775: TPP_enzyme_C
  • amino acids 957 to 1067 (111 residues), 28.8 bits, E=4.1e-10

Best Hits

Swiss-Prot: 100% identical to NIFJ_KLEPN: Pyruvate-flavodoxin oxidoreductase (nifJ) from Klebsiella pneumoniae

KEGG orthology group: K03737, putative pyruvate-flavodoxin oxidoreductase [EC: 1.2.7.-] (inferred from 62% identity to aoe:Clos_0237)

MetaCyc: 65% identical to pyruvate:ferredoxin oxidoreductase subunit (Clostridium acetobutylicum)
Pyruvate synthase. [EC: 1.2.7.1]

Predicted SEED Role

"Pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)" in subsystem Methionine Degradation or Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.-)

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• L-alanine degradation V (oxidative Stickland reaction) (2/2 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (7/9 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (7/9 steps found)
• glycerol degradation to butanol (12/16 steps found)
• pyruvate decarboxylation to acetyl CoA III (1/1 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• pyruvate fermentation to acetate and alanine (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• pyruvate fermentation to acetate III (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• pyruvate fermentation to acetone (3/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• L-glutamate degradation VII (to butanoate) (7/12 steps found)
• reductive TCA cycle II (7/12 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.-, 1.2.7.1

Use Curated BLAST to search for 1.2.7.- or 1.2.7.1

Sequence Analysis Tools

See A0A285B6N3 at UniProt or InterPro

Protein Sequence (1171 amino acids)

>BWI76_RS18805 pyruvate:ferredoxin (flavodoxin) oxidoreductase (Klebsiella michiganensis M5al)
MSGKMKTMDGNAAAAWISYAFTEVAAIYPITPSTPMAENVDEWAAQGKKNLFGQPVRLME
MQSEAGAAGAVHGALQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALATNS
LNIFGDHQDVMAVRQTGCAMLAENNVQQVMDLSAVAHLAAIKGRIPFVNFFDGFRTSHEI
QKIEVLEYEQLATLLDRPALDSFRRNALHPDHPVIRGTAQNPDIYFQEREAGNRFYQALP
DIVESYMTQISALTGREYHLFNYTGAADAERVIIAMGSVCDTVQEVVDTLNAAGEKVGLL
SVHLFRPFSLAHFFAQLPKTVQRIAVLDRTKEPGAQAEPLCLDVKNAFYHHDDAPLIVGG
RYALGGKDVLPNDIAAVFDNLNKPLPMDGFTLGIVDDVTFTSLPPRQQTLAVSHDGITAC
KFWGMGSDGTVGANKSAIKIIGDKTPLYAQAYFSYDSKKSGGITVSHLRFGDRPINSPYL
IHRADFISCSQQSYVERYDLLDGLKPGGTFLLNCSWSDAELEQHLPVGFKRYLARENIHF
YTLNAVDIARELGLGGRFNMLMQAAFFKLAAIIDPQTAADYLKQAVEKSYGSKGAAVIEM
NQRAIELGMASLHQVTIPAHWATLDEPAAQASAMMPDFIRDILQPMNRQCGDQLPVSAFV
GMEDGTFPSGTAAWEKRGIALEVPVWQPEGCTQCNQCAFICPHAAIRPALLNGEEHDAAP
VGLLSKPAQGAKEYHYHLAISPLDCSGCGNCVDICPARGKALKMQSLDSQRQMAPVWDYA
LALTPKSNPFRKTTVKGSQFETPLLEFSGACAGCGETPYARLITQLFGDRMLIANATGCS
SIWGASAPSIPYTTNHRGHGPAWANSLFEDNAEFGLGMMLGGQAVRQQIADDMTAALALP
VSDELSDAMRQWLAKQDEGEGTRERADRLSERLAAEKEGVPLLEQLWQNRDYFVRRSQWI
FGGDGWAYDIGFGGLDHVLASGEDVNILVFDTEVYSNTGGQSSKSTPVAAIAKFAAQGKR
TRKKDLGMMAMSYGNVYVAQVAMGADKDQTLRAIAEAEAWPGPSLVIAYAACINHGLKAG
MRCSQREAKRAVEAGYWHLWRYHPQREAEGKTPFMLDSEEPEESFRDFLLGEVRYASLHK
TTPHLADALFSRTEEDARARFAQYRRLAGEE