Protein Info for BWI76_RS18790 in Klebsiella michiganensis M5al

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 TIGR00484: translation elongation factor G" amino acids 1 to 697 (697 residues), 1158.1 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 104.3 bits, see alignment E=5.7e-34 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 210.2 bits, see alignment E=6.5e-66 PF22042: EF-G_D2" amino acids 314 to 397 (84 residues), 63.1 bits, see alignment E=6.5e-21 PF03144: GTP_EFTU_D2" amino acids 329 to 396 (68 residues), 70.4 bits, see alignment E=4.3e-23 PF14492: EFG_III" amino acids 409 to 482 (74 residues), 120.7 bits, see alignment E=6.6e-39 PF03764: EFG_IV" amino acids 484 to 603 (120 residues), 163 bits, see alignment E=7.3e-52 PF00679: EFG_C" amino acids 607 to 691 (85 residues), 105.3 bits, see alignment E=4.2e-34

Best Hits

Swiss-Prot: 78% identical to EFG1_POLSJ: Elongation factor G 1 (fusA1) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02355, elongation factor G (inferred from 97% identity to kva:Kvar_1606)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6A4 at UniProt or InterPro

Protein Sequence (700 amino acids)

>BWI76_RS18790 elongation factor G (Klebsiella michiganensis M5al)
MPRPIPLERYRNIGISAHIDAGKTTTTERILFYTGMSHKLGEVHDGAATTDWMAQEQERG
ITITSAAVSCFWPGMDRSFEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYDSVGGVQ
PQSETVWRQANKYHVPRLAFVNKMDRPGADFFRVVQMMTDRLKANPVPIVIPVGAEEHFT
GVVDLIKMRAILWDDATQGMTFSYAPVPDDLVETARLWREKMVSAAAEANDELMDKYLET
GELSEAEIVAGLRQRTVKGEIQAVLCGSAFKNKGVQRMLDAVVELMPSPLDIPAIQGVDE
KGQPAERHPNDDEPFSALAFKLMTDPYVGQLTFIRVYSGTLKKGDAVWNPVKGKKERIGR
IVLMQANDRHEVDELHAGDIAACVGLKDVTTGDTLCDPDAVITLERMEFPEPVISLAIEP
KTKADQEKMGIALQRLAAEDPSFRLHTDEESGQTIISGMGELHLEIIVDRMKREFGVEAN
IGRPQVTYRETIRKTVKEVEGKFVRQSGGKGQYGHVVLTLEPLEPGSGFVFEDATKGGVV
PREYIPSVEKGLREAMGTGVLAGYPVVDIKATLTFGSYHDVDSSEMAFRMAAIFGFKEGA
RRADPVILEPVMHVEVETPEEYAGNIMGDLSSRRGMVQGMEERFGSQIIRADVPLAEMFG
YSTTLRSMSQGRATYSMEFHHYAEAPRNVAEAIIASRAKG