Protein Info for BWI76_RS18770 in Klebsiella michiganensis M5al

Annotation: DNA gyrase inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF06445: GyrI-like" amino acids 1 to 152 (152 residues), 86.1 bits, see alignment E=3.3e-28 PF14526: Cass2" amino acids 10 to 152 (143 residues), 84.5 bits, see alignment E=9.2e-28

Best Hits

Swiss-Prot: 74% identical to SBMC_KLEP3: DNA gyrase inhibitor (sbmC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K07470, DNA gyrase inhibitor (inferred from 76% identity to kpu:KP1_3671)

Predicted SEED Role

"DNA gyrase inhibitory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6F1 at UniProt or InterPro

Protein Sequence (157 amino acids)

>BWI76_RS18770 DNA gyrase inhibitor (Klebsiella michiganensis M5al)
MEYNVKSVGKKKIAGFHLVGPWEQTVKQGFEQLMMWVDNSQVPAQEWVAVYYDNPDEVPA
EKLRCATAVTVAEDYSIPANSEGVMMTDIAGGEYAVARARVENYDFATPWYQFFESLMQS
KTHQMAMKPCFEVYLNDGNQDGYWDIDMYIAVEPAVK