Protein Info for BWI76_RS18755 in Klebsiella michiganensis M5al
Annotation: adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Predicted SEED Role
"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)
MetaCyc Pathways
- adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
- adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
- adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
- adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
- adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)
Isozymes
Compare fitness of predicted isozymes for: 2.7.7.62
Use Curated BLAST to search for 2.7.7.62
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B6M2 at UniProt or InterPro
Protein Sequence (77 amino acids)
>BWI76_RS18755 adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase (Klebsiella michiganensis M5al) MILITGDAHSGQRRDAESLLNSFVSAIYIATSRISDNQIAARIQHHRDTRLAHWRLEERG RAQAARTSQVTAGGGDE