Protein Info for BWI76_RS18750 in Klebsiella michiganensis M5al

Annotation: adenosylcobinamide-GDP ribazoletransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 183 to 214 (32 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 1 to 245 (245 residues), 245.9 bits, see alignment E=2.6e-77 PF02654: CobS" amino acids 8 to 243 (236 residues), 190.3 bits, see alignment E=2.4e-60

Best Hits

Swiss-Prot: 87% identical to COBS_KLEP3: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 87% identity to kva:Kvar_1614)

MetaCyc: 76% identical to adenosylcobalamin 5'-phosphate synthase (Salmonella enterica enterica serovar Typhimurium)
Adenosylcobinamide-GDP ribazoletransferase. [EC: 2.7.8.26]; 2.7.8.26 [EC: 2.7.8.26]; 2.7.8.26 [EC: 2.7.8.26]; 2.7.8.26 [EC: 2.7.8.26]

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6A1 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS18750 adenosylcobinamide-GDP ribazoletransferase (Klebsiella michiganensis M5al)
MIKSFFAALSFISRLPVPARLSQGLEIEQYQRSIVTFPLVGLLLGAIAGAVVMLLQPWCG
GPLAALLGVLALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV
LMAKVLVVSEVALRGTSTLAALAAACAVGRGMAVLLMYRQRYAREEGLGNLFIGKITLRQ
TLITMGIALALAIVLLGVNGLRAALITLVLVWALGQALKRTLGGQTGDTLGAAIELGEVI
FLLALL