Protein Info for BWI76_RS18745 in Klebsiella michiganensis M5al

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05221: AdoHcyase
  • amino acids 9 to 127 (119 residues), 42.5 bits, E=1.2e-14
• PF02826: 2-Hacid_dh_C
  • amino acids 177 to 278 (102 residues), 50.3 bits, E=4.7e-17
• PF00670: AdoHcyase_NAD
  • amino acids 182 to 323 (142 residues), 119.2 bits, E=4.9e-38
• PF13241: NAD_binding_7
  • amino acids 186 to 281 (96 residues), 22.5 bits, E=3.7e-08
• PF07991: KARI_N
  • amino acids 188 to 252 (65 residues), 28.7 bits, E=2.4e-10

Best Hits

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 92% identity to kva:Kvar_1616)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

See A0A285B630 at UniProt or InterPro

Protein Sequence (369 amino acids)

>BWI76_RS18745 adenosylhomocysteinase (Klebsiella michiganensis M5al)
MNNKIKLEKEIAWASQNMPRTLRQVAALPDLSEVRLACCMHLDMKMIPLVQGILEKGAKV
FLTTCNPTTVQDEVVAWLVERGAEACAWRDMSDADWQQSWEKAIAWQPTHLCEMGADITT
LLHQRGEFGNVVAGLEATGSGVSRLGDIRPGYPIFNWDDLPVKEGLHNRHMVGLTAWHTF
FQTTHLTLHEKKVLVIGYGLVGQGVAAAAKAFGGQVMVAEIDPARRLQAAYDGWHVVELQ
EAIASADVVATATGGKKVVNRQALDKSKDGVFILNVGHVAEEIDCEYLRQFAQEEVMPYI
NAYRMGDKTVYLLANGSMLNLTAGFGDSLNAFDVTLAVMASGIQHIVTDGMNAPADVYLL
PQSVWQKAL