Protein Info for BWI76_RS18740 in Klebsiella michiganensis M5al

Annotation: HPP family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 91 to 121 (31 residues), see Phobius details amino acids 123 to 125 (3 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details PF04982: HPP" amino acids 62 to 181 (120 residues), 138.1 bits, see alignment E=8.4e-45

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 90% identity to kpu:KP1_3665)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B641 at UniProt or InterPro

Protein Sequence (243 amino acids)

>BWI76_RS18740 HPP family protein (Klebsiella michiganensis M5al)
MLSVLPGSLFSRIRIFLGRLKPHALPVARKHIVLASIGAGTGLAVTSLFSHWLLGEVNIW
FIAPMGASAVLLFGVPSSPLAQPWSIVGGNVLSALIGVTVGIAIPNLALACGVAAGLAIA
GMYFLRCLHPPGGAVALTAILGGAGVQSEGYHFVLTPVLLNSLMLALLAIVFNNLVGRRY
PHPLAAEEVKAKAVPLGLSVTRDDIHAALLDGQFLDIDEDDVQELLENIEQKARQRIAGA
RRS