Protein Info for BWI76_RS18710 in Klebsiella michiganensis M5al

Annotation: GGDEF-domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 166 to 188 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 222 to 384 (163 residues), 128.6 bits, see alignment E=9.8e-42 PF00990: GGDEF" amino acids 226 to 379 (154 residues), 133.8 bits, see alignment E=4.9e-43 PF00563: EAL" amino acids 401 to 632 (232 residues), 269.8 bits, see alignment E=1.9e-84

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_23265)

Predicted SEED Role

"FIG00731454: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6K9 at UniProt or InterPro

Protein Sequence (641 amino acids)

>BWI76_RS18710 GGDEF-domain containing protein (Klebsiella michiganensis M5al)
MNRILTAIILLLFLVTGYITYLVHERQSELQKLTRYTDSWSVSQIVSEYMRLEARLSAMG
LEVKGSDHDEVRLRLEIMMSQIALLQQGDLGKFIGKDPHRKAIVDSLIGLLGRLDKQLDT
MSTAQLKLMLQEMSTLDGPLTSLASTSLAQDFNLVNLTHDKIQNLYYIYSAISILLIILC
ITLGLLMLKQNNTLRRAHVRMKLLATDLQASKEKLQVQNRRLQYDAYHDSLTGMPNRLSF
WQRLQEVVNQVRPYNGSAVVMLFDLDNFKDVNDTQGHDAGDKLLQDLASRLSFFRKTSET
LYRLGGDEFALVSHDLNEEMALERAEAIREKISQPYQIYDTLIQIGACIGIVISDGESRT
DYLYKCADLALYEAKKAGSGKVQVYRPGLLQRQQENKSFEDDLMQALNKGEFRVYYQPIA
DTLNGEIYGYEALVRWFHPLRGSVPPTEFIPVAEKIGLINQLGEWVLRTACEAAASWSSP
LKVSVNVSPIQLINSSLTDTVVAILRSTELDPHRLDLEITESDVFNENTRSLEILSQLRE
LGVQISIDDFGTGYSSLSRLSYFPFDKIKIDRSFVINIPDQKDDLDIVRLIISMGKSLHM
RIVAEGVETEEQLQSLRKLGCDLVQGYLIGKPGPLNSPENR