Protein Info for BWI76_RS18705 in Klebsiella michiganensis M5al

Annotation: tellurite resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF09313: TehB-like" amino acids 14 to 98 (85 residues), 75.3 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 66% identical to YEAR_ECOLI: Uncharacterized protein YeaR (yeaR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to kpu:KP1_3657)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>BWI76_RS18705 tellurite resistance protein (Klebsiella michiganensis M5al)
MQRIIIPTHYVHTRSTPLWTKQTAPASIWKRHLDAGTRQGVYPRLSVMRGAIRYFGYANE
TSADPLETLTIAEGEFGVFPPEKWHRIEALTEDTVFNVDFYVDPKILIEG