Protein Info for BWI76_RS18585 in Klebsiella michiganensis M5al

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 11 to 468 (458 residues), 463.1 bits, see alignment E=5.5e-143 PF00672: HAMP" amino acids 192 to 245 (54 residues), 37.4 bits, see alignment 4e-13 PF00512: HisKA" amino acids 250 to 313 (64 residues), 48 bits, see alignment E=1.6e-16 PF02518: HATPase_c" amino acids 359 to 465 (107 residues), 71.6 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 77% identity to spe:Spro_1499)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5V3 at UniProt or InterPro

Protein Sequence (472 amino acids)

>BWI76_RS18585 two-component sensor histidine kinase (Klebsiella michiganensis M5al)
MNVLARRWQATSLTLRSAVLFALVAALVVSAAGGYLYHAMRQEMIHRSDLQVTGRIEYYR
NVLSKRFPLERLVANTAMFENMLGNEQDVLIFRIPGQAPLINVNPARVQLPSVTPTPADR
PQRLNEVQSGMTGQGVPLRVASGLVTLEDGRVLQISVAHVMVNEQKMLARYLWRVIAAVA
VAFLAIALLGYWVMRRELRPLRRMAAEAAIITPSTLATRLSEQDAPQELQQLIVSFNAML
DRLNEGYQRLTRFSADLAHEIRTPIGALMGQCQVALYQPRSVEEYETLLSSNMEELERIS
RMVENILFLARASHAQSVLNCRELDIAQELQRVADYFEGLAEERDIQLICEGEGQLWADA
MLFQRALSNLVANAVRYADEASQIILRAGMEENRQVIQVINQGPPIAQVHLEKLFERFYR
ADAARSSHASGLGLSIVRAIMTLHGGEARAQCLSQQPGAQIVFSLIFPKRSA