Protein Info for BWI76_RS18555 in Klebsiella michiganensis M5al

Annotation: MATE family multidrug exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 294 to 320 (27 residues), see Phobius details amino acids 341 to 368 (28 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details PF01554: MatE" amino acids 37 to 197 (161 residues), 119.9 bits, see alignment E=4.5e-39 amino acids 267 to 428 (162 residues), 76.4 bits, see alignment E=1e-25 TIGR00797: MATE efflux family protein" amino acids 37 to 441 (405 residues), 237.3 bits, see alignment E=1.4e-74

Best Hits

Swiss-Prot: 79% identical to YEEO_ECOLI: Probable FMN/FAD exporter YeeO (yeeO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to kpu:KP1_3579)

MetaCyc: 79% identical to FMN/FAD exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-272; TRANS-RXN0-595

Predicted SEED Role

"FIG01069516: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5W3 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BWI76_RS18555 MATE family multidrug exporter (Klebsiella michiganensis M5al)
MNVTAALRQSVERTSWFKKRKSYRVLYWREISPLAVPILLENACVLLMGVLSTFLVSWLG
KEAMAGVGLADSFNMVIMSFFAAIDLGTTVVVAFSLGKRDRRRARAAARQSLAIMTLFSI
ILAAVIHAFGAEIINFVAGDATEEVKGLALTYLELTVLSYPAAAIALIGSGALRGAGTTK
IPLLINGGMNILNIIISSILIYGIFSWPGMGFVGAGLGLTIARYIGAVATIWVLMIGFNP
ALRISLKSYFKPFNFAIIWEVMGIGIPASIESVLFNGGKLLTQMFVAGMGTNVIAGNFIA
FSVAALINLPGNALGSASTIITGRRLGKGQIGQAERQAWHVFWLSTIILTVIAWGTAPLA
GLIASFYTSEEDVKVVVKELLWLNAFFMPIWAMAWTLPCAFKGARDVRYTMWVSMLGMWG
CRVVAGYTLGIVLGMGVIGVWLGMVLDWAVRGVLFYCRMVSGRWLWKYPRTKAQREETSA
PAKES