Protein Info for BWI76_RS18545 in Klebsiella michiganensis M5al

Annotation: AMP nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR01717: AMP nucleosidase" amino acids 10 to 484 (475 residues), 787.6 bits, see alignment E=2.2e-241 PF10423: AMNp_N" amino acids 12 to 167 (156 residues), 166.3 bits, see alignment E=4.4e-53 PF01048: PNP_UDP_1" amino acids 267 to 432 (166 residues), 77.3 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 87% identical to AMN_ECOLI: AMP nucleosidase (amn) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_23205)

MetaCyc: 87% identical to AMP nucleosidase (Escherichia coli K-12 substr. MG1655)
AMP nucleosidase. [EC: 3.2.2.4]

Predicted SEED Role

"AMP nucleosidase (EC 3.2.2.4)" in subsystem Purine conversions (EC 3.2.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B651 at UniProt or InterPro

Protein Sequence (484 amino acids)

>BWI76_RS18545 AMP nucleosidase (Klebsiella michiganensis M5al)
MNQKAARLTPEQALRQLEALYEKSVNALRKAIGDYIHHNILPENSARAEGLFVYPQLSVS
WDGAEHKALKTRAWGRFTHSGCYTTTITNPKLFRAYLLEQLTMLYQDYDAAITVGLSQHE
IPYPYVIDGSELTLDRSMSAGLTRFFPTTELSQIGDETADGLFHSTEYYPLSHFDARRVD
FSLARLRHYTGTPVDHFQPYMLFTNYTRYVDEFVRWGCSQILDPESPYIALSCAGGIWIT
ADTEAPEEAISDLAWKKHQMPAWHLITKDGQGITLINIGVGPANAKNICDHLAVLRPDVW
LMIGHCGGLRESQNIGDYVLAHAYLRDDHVLDAVLPPDIPIPSIAEVQRALYDATKQVSG
MPGEEVKQRLRTGTVVTTDDRNWELRYSASALRFNLSRAVAIDMESATIAAQGYRFRVPY
GTLLCVSDKPLHGEIKLPGQANRFYEGAISEHLQIGIRAIDLLRAEGDHMHSRKLRTFNE
PPFR