Protein Info for BWI76_RS18535 in Klebsiella michiganensis M5al

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF12146: Hydrolase_4" amino acids 129 to 254 (126 residues), 46.4 bits, see alignment E=4.7e-16 PF12697: Abhydrolase_6" amino acids 135 to 296 (162 residues), 40.3 bits, see alignment E=8.7e-14 PF00561: Abhydrolase_1" amino acids 135 to 224 (90 residues), 29.4 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: None (inferred from 76% identity to eae:EAE_23195)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B659 at UniProt or InterPro

Protein Sequence (513 amino acids)

>BWI76_RS18535 alpha/beta hydrolase (Klebsiella michiganensis M5al)
MAMMRFTRLLNKSGLRMVSVVKKAIIGLLVVVIVFFIGRIYESQRGPALHRWHTWTANEM
TASEIDHATFAEYQTREAAIFRDMKSKITDTLSDDEKTAINRFYAQSLVYPDKFHPDWNR
SFILLPQGKPRGAAVLLHGLTDSPYSVHYLAQRYQQQGFVAVAPRLPGHGTAPGALTGVD
REEWIATTRLAVREATRLAGDDAPLHVVGYSNGGALALKYALDSLEDKSLRRPQQVILLS
PMIGVTAFARFAGLAGLPSVFPAFARAAWLNIVPEFNPYKYNSFPVKAARQSWLLSQALQ
QQIVQEAQSKRLSELAPVLTFQSVMDSTVSTRAVVDSLYRYLPDNGSELVIFDINQAANL
RALFRPSLYSAVNTLLPPAPRPYGTTVITNAAPDTYETVARTTLAGTRSETVTPLHIAWP
QDMYSLSHVAVPFPLSDSLYGREPAEKNRYGISIGTISLRGETATLSVGLDTLMRVTSNP
FFPWMMVRINHHIACSDRADIAACLRPESAASE