Protein Info for BWI76_RS18520 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 18 to 309 (292 residues), 55.3 bits, see alignment E=2.9e-19

Best Hits

KEGG orthology group: None (inferred from 98% identity to kpe:KPK_A0098)

Predicted SEED Role

"FIG00731324: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6C8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BWI76_RS18520 hypothetical protein (Klebsiella michiganensis M5al)
MNSTGLNIIKTLGCMTAVTFFTIYNTWDSYDYDYHWILGFLTFISTIATPLFFVVAGYLD
SQSRHDSQWQLGKIKSVVIVFLFWMTVYYLWEPYQRGYLIQPWFVFAFIVIYTFHPVIEW
LSQRRAAFFATVFSLLLLSYGYDLLSALYPDIHALSLAPQYRLWTWLLFYLTGQLFSDPL
VADWLRREKVVKGAMIAIPFIYLFTWFYERHFFFALFKADRNAFILTGSQIYILVVALVI
AANGVRFRKNSEFKETLLATISKTMTGVYILHYSVFHLLTAFIPINSLGTKLMLIVLTFI
TSVLISMLALSNSLIKKVITI