Protein Info for BWI76_RS18500 in Klebsiella michiganensis M5al

Annotation: cation transporting ATPase E1-E2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 895 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details amino acids 80 to 80 (1 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 693 to 717 (25 residues), see Phobius details amino acids 723 to 744 (22 residues), see Phobius details amino acids 764 to 784 (21 residues), see Phobius details amino acids 795 to 813 (19 residues), see Phobius details amino acids 834 to 853 (20 residues), see Phobius details amino acids 865 to 884 (20 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 11 to 76 (66 residues), 67.4 bits, see alignment 2e-22 TIGR01494: HAD ATPase, P-type, family IC" amino acids 88 to 351 (264 residues), 129.5 bits, see alignment E=6.2e-42 amino acids 600 to 725 (126 residues), 121.8 bits, see alignment E=1.3e-39 PF00122: E1-E2_ATPase" amino acids 117 to 229 (113 residues), 96.2 bits, see alignment E=2.8e-31 PF00702: Hydrolase" amino acids 328 to 646 (319 residues), 54.1 bits, see alignment E=8.6e-18 PF13246: Cation_ATPase" amino acids 384 to 542 (159 residues), 92.5 bits, see alignment E=8.8e-30 PF08282: Hydrolase_3" amino acids 618 to 677 (60 residues), 22.2 bits, see alignment 3.2e-08 PF00689: Cation_ATPase_C" amino acids 717 to 886 (170 residues), 149.2 bits, see alignment E=3.3e-47

Best Hits

KEGG orthology group: None (inferred from 99% identity to kpe:KPK_A0103)

Predicted SEED Role

"Putative cation-transporting P-type ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5V0 at UniProt or InterPro

Protein Sequence (895 amino acids)

>BWI76_RS18500 cation transporting ATPase E1-E2 family protein (Klebsiella michiganensis M5al)
MSTEKPGGPFYQLSVEETLTSTNSTPEGISGAEASARLQQYGENALPQKAGKPAWLRFLA
HFNDVLIYVLLAAALLTAVMGHWVDTLVILGVAVINALIGHIQESNAEKSLQSIRNMLSS
EAVVIRQGNHETIPTTALVPGDIVVIRAGDRIPADLRVIEAHNLRVEEAILTGESTVVEK
STEALSGELPLGDRTNLLFSGTTVSSGGGKGLVVATGGDTELGHINQMMSDIEKHRTPLL
VQMDKLGKAIFIIILVMMAALFVFSLLFRDMPVSELMLSLISLAVASVPEGLPAIISIIL
SLGVQTMARQKAIIRKLPTVETLGAMTVICSDKTGTLTMNEMTVKAVITADKVYRVEGDS
YEPVGNIHPIDEPAPITVAPGTLLERYLRTIDLCNDSQLIKDESGLWKITGGPTEGALKV
LAAKVPLPAVNTELRSKIPFDSQYKYMSTLYRIGDEEMILITGAPDVLFRLCQHQQTDHG
LEPLDQPYWEAKIEEYAREGLRMVAAAWKPAADGQTELGHQDLQQGVILLGIAGMMDPPR
PEAITAIGDCLQAGIRVKMITGDHPQTAMSIGKMLGIGNAENAITGRELEVMDDIQLSEA
AQKFDIFARTSPEDKFRLVQALQSRKEVVGMTGDGVNDAPALKQADVGIAMGIKGTEVTK
EAADMVLTDDNFATIASAVREGRRVYDNLKKTILFIMPTNLAQGLLIIIALLAGNLIPLT
PVLILWMNMATSATLSFGLAFEAGEKNIMRRPPRDPKLHVMDGFAIWRVIFVGSMIAVSA
FVLEAWLQPRGYSPEFIRTVLLQTLVTAQWFYMLNCRVADGFSLSKGLLANRGIWIVSGV
LLVLQLLIIYAPFMQMLFGTEALPFRYWVITFIIGFVMFLIVEVEKPLTRRWRTA