Protein Info for BWI76_RS18460 in Klebsiella michiganensis M5al

Annotation: DgsA anti-repressor MtfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF06167: Peptidase_M90" amino acids 19 to 243 (225 residues), 204.4 bits, see alignment E=1.1e-64

Best Hits

Swiss-Prot: 89% identical to MTFA_KLEP7: Protein MtfA (mtfA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_23165)

MetaCyc: 81% identical to Mlc titration factor (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"FIG01220476: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5Y9 at UniProt or InterPro

Protein Sequence (265 amino acids)

>BWI76_RS18460 DgsA anti-repressor MtfA (Klebsiella michiganensis M5al)
MFKWPWKADEESGNAEIPWEKALAIPVLANLSEHEQQQLVQMASRFLQQKRLVALQGLEL
TPLHSARIALLFCLPVLELGIEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHNQRIVQSGQ
SWQQGPIVLNWLDIQDSFDASGFNLIVHEVAHKLDTRNGDRASGVPFIPLREVAGWEHDL
HAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCL
FYRQDPLKRLRENSPPDDSDNPVVH