Protein Info for BWI76_RS18435 in Klebsiella michiganensis M5al

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13609: Porin_4" amino acids 12 to 330 (319 residues), 67.4 bits, see alignment E=2e-22 PF00267: Porin_1" amino acids 27 to 356 (330 residues), 395.5 bits, see alignment E=2.7e-122

Best Hits

Swiss-Prot: 73% identical to YEDS_ECOLX: Outer membrane protein YedS (yedS) from Escherichia coli

KEGG orthology group: None (inferred from 73% identity to ecl:EcolC_1679)

MetaCyc: 57% identical to outer membrane porin F (Escherichia coli K-12 substr. MG1655)
RXN0-2481; RXN0-7199; RXN0-7200; RXN0-7201; RXN0-7202; RXN0-7203; RXN0-7204; RXN0-7206; RXN0-7207; RXN0-7208; RXN0-7209; RXN0-7210; RXN0-7211; RXN0-7241; RXN0-7242; RXN0-7243; RXN0-7244; RXN0-7245; RXN0-7246; RXN0-7247; TRANS-RXN-380; TRANS-RXN0-490; TRANS-RXN0-598; TRANS-RXN0-601; TRANS-RXN0-603; TRANS-RXN0-604; TRANS-RXN0-606; TRANS-RXN0-607; TRANS-RXN0-608; TRANS-RXN0-609; TRANS-RXN0-611; TRANS-RXN0-612; TRANS-RXN0-614; TRANS-RXN0-615

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B638 at UniProt or InterPro

Protein Sequence (356 amino acids)

>BWI76_RS18435 porin (Klebsiella michiganensis M5al)
MKRKVLAILVPALLVAGAANAAEIYNKNGNKLDFYGKMVGEHIMTHDGDNNNSDDTSYAR
FGIKGETQISSELTGYGQFEYNIKADKPEGQQGSATRLAFAGLKFSDYGSFDYGRNDGVV
YDAAGYTDMLVEWGGDGLVYTDNFMTGRTNGVATYRNTDFFGMVDGLNFALQYQGKNNDT
TAKKSNGDGFGFSVNYNIDGFGFVGAYSNSDRTDEQAADKRGETAEVWNLAAKYDANNLY
ASVMYGESRNMTPLEKTTFGSFANHTQNIEAVVQYQFDFGLRPSLGYVYAKGKDLGAKED
TNADIMNYVELGTWYYFNKNFNVYTAYKFNLIDDEDAAVSGAATDDQFAVGITYQF