Protein Info for BWI76_RS18360 in Klebsiella michiganensis M5al

Annotation: aminocyclopropane-1-carboxylate deaminase/D-cysteine desulfhydrase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01275: pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  • amino acids 12 to 328 (317 residues), 457.1 bits, E=1.7e-141
• PF00291: PALP
  • amino acids 15 to 316 (302 residues), 178.3 bits, E=1.2e-56

Best Hits

Swiss-Prot: 94% identical to DCYD_KLEP3: D-cysteine desulfhydrase (dcyD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_23050)

MetaCyc: 90% identical to D-cysteine desulfhydrase (Escherichia coli K-12 substr. MG1655)
3-chloro-D-alanine dehydrochlorinase. [EC: 4.5.1.2]; D-cysteine desulfhydrase. [EC: 4.5.1.2, 4.4.1.15]

Predicted SEED Role

"D-cysteine desulfhydrase (EC 4.4.1.15)" (EC 4.4.1.15)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.15 or 4.5.1.2

Sequence Analysis Tools

See A0A285B5W8 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BWI76_RS18360 aminocyclopropane-1-carboxylate deaminase/D-cysteine desulfhydrase family protein (Klebsiella michiganensis M5al)
MSLQNLTLFPRLELIGAPTPLEYLPRLSDYLGREIFIKRDDVTPLAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTRAENYLTNGNRLLLD
LFNTQVEMCDALTDPNAQLEELATRIEAQGYRPYTIPVGGSNALGALGYVESALEIAQQC
EGAVELSSVVVASGSAGTHAGLAVGLEQLMPNAELIGVTVSRKVADQLPKVAALQQAVAN
SLELEAKAGIQLWDDYFAPGYGTPNDEGMAAVKLLAQLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFVHTGGAPALFAYHPHI