Protein Info for BWI76_RS18355 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 90 to 104 (15 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 118.2 bits, see alignment E=9.2e-39 PF00528: BPD_transp_1" amino acids 33 to 214 (182 residues), 99.7 bits, see alignment E=8.5e-33

Best Hits

Swiss-Prot: 93% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K10009, cystine transport system permease protein (inferred from 97% identity to kva:Kvar_1691)

MetaCyc: 93% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5R2 at UniProt or InterPro

Protein Sequence (222 amino acids)

>BWI76_RS18355 amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MQESIQLVIDSAPFLLKGAVFTLQLSIGGMFFGLVLGFILALMRMSPVWPIKWLARMYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPAAMIGLSLNTAAYAAETLRAAIASIDKGQWE
AAASIGMTRWQAMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWVMATVLSTLQNYFENQLNRQERDPK