Protein Info for BWI76_RS18275 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details PF06609: TRI12" amino acids 10 to 185 (176 residues), 27.4 bits, see alignment E=1.9e-10 PF07690: MFS_1" amino acids 21 to 411 (391 residues), 167.8 bits, see alignment E=4.8e-53

Best Hits

KEGG orthology group: None (inferred from 87% identity to eae:EAE_22975)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B607 at UniProt or InterPro

Protein Sequence (474 amino acids)

>BWI76_RS18275 MFS transporter (Klebsiella michiganensis M5al)
MSTNTSSRDDRSFSGPALLVAGAFFMEFLDGTVIATALPDMAKDFGVTAVDLNIGISAYL
ITLAVLIPASGWIADRFGARKIFTLALAIFTLASVFCGLSTHVDVFVAMRILQGIGGALM
VPVGRLAVLRTTPKHQLIKAIATLTWPALVAPIIGPPLGGFITRYASWHWIFFINVPLGL
IAIALSLRIIPNIREDERRPFDLPGFLATSVAMISLVAAMELLGERQPLGWHTLALLALG
LGCMLFSLRHFRRTAWPMVRLDALQIPTFRVTMYGGSLFRASISAVPFLLPLLFQVGFGM
DPFHSGLLVLAVFVGNLTIKPLTTPLIRWLGFRRLLLINGALNVFSLLACAFLTPQTPVW
LILVILYLGGVFRSIQFTGISTLAFADVPATQMSYANTLFSTASQLAVGLGITLGAIGIR
LGEAFSDWFTLSHLPGISFRLSFIFIALICLVGMIDSLHLSREAGSSVSNKTSR