Protein Info for BWI76_RS18265 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details PF13347: MFS_2" amino acids 25 to 457 (433 residues), 171.8 bits, see alignment E=2e-54 PF07690: MFS_1" amino acids 41 to 399 (359 residues), 51.4 bits, see alignment E=8.1e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to kva:Kvar_1707)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5N8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>BWI76_RS18265 MFS transporter (Klebsiella michiganensis M5al)
MARYTASASQGLQGRPILLRHQLAYGGGNLLGSGALAISGAWLLYFYTTFCGLTLIEASF
IFSVASIIDAISNPLMGYLTDNFGKTRLGKRFGRRRFFLLIGIPLMMFYPLLWVEGLGFW
YYLCTYVVFEIIYTSIMVPYETLATEMTDDFSLRSKLTGYKAIFGKLANFLAAFIPGQFI
LLYGKESATPFFLTGLTYGVILIVAISCLWYCSWERPREEEMSKGKKKGLLSTLLMLAKD
MRSTFYLRVFRKHLGMYLCGFGAEWLFASIFTYFVIFVLQHDPAMVAGLNSLNSILQLVS
TALFIGLCVKKGFSKPYILALSVVIFAVLLYTSLWFFHLPAHLATILMFGITVLFGLGTG
GVYYIPWTVYTFLADVDEIYTGRRREGIYAGAMTFSGKILRSIIVFSMGAILSFYGFQSK
AHTQPESAVTAIAVVFCAGVILLALAAIVFSKQMKLDRKAHLVVLQEVARIKAGGKIGDI
APEVRLIVEDLVGHRYEECWGNSKLFKDTQKGAIQTAVSH