Protein Info for BWI76_RS18245 in Klebsiella michiganensis M5al

Annotation: L-arabinose transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF00005: ABC_tran" amino acids 23 to 172 (150 residues), 119.4 bits, see alignment E=1.8e-38 amino acids 274 to 427 (154 residues), 70.7 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 89% identical to ARAG_SHIBS: Arabinose import ATP-binding protein AraG (araG) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_22955)

MetaCyc: 88% identical to arabinose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5U8 at UniProt or InterPro

Protein Sequence (504 amino acids)

>BWI76_RS18245 L-arabinose transporter ATP-binding protein (Klebsiella michiganensis M5al)
MQQSTPYLSFHGITMTFPGVKALSDISFGCYAGQVHALMGENGAGKSTLLKILSGNYIPT
AGSLQIRGQQMTFNHTTEALNAGVAIIYQELHLIPEMTVAENIYLGQLPHKGGIVNRSLL
NYEAGLQLKHLGLDIDPETPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIE
NLFRVIRELRQEGRVIIYVSHRMEEIFALSDAITVFKDGRYVRTFDNMQEVNHDALVQAM
VGRELGNIYGWQPREYGKERLRLEQVKAPGVRQPVSLSVRSGEIVGLFGLVGAGRSELMK
GLFGGSRITGGQVYIDGEAIDIRKPAQAIQAGMMLCPEDRKAEGIIPVHSVRDNINISAR
RKHILAGCVINNAWEAQNADQHIKSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKV
ILLDEPTRGIDVGAKHEIYNVIYALAASGVAVVFASSDLPEVLGVADRIVVMREGEIAGE
LLHEHANEQQALSLAMPKVSQAVA