Protein Info for BWI76_RS18235 in Klebsiella michiganensis M5al
Annotation: trehalose-phosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to OTSB_SALTY: Trehalose-phosphate phosphatase (otsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 73% identity to eae:EAE_22945)MetaCyc: 63% identical to trehalose-6-phosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Trehalose-phosphatase. [EC: 3.1.3.12]
Predicted SEED Role
"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)
MetaCyc Pathways
- trehalose biosynthesis I (2/2 steps found)
- trehalose biosynthesis II (1/2 steps found)
- trehalose biosynthesis III (1/2 steps found)
- glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
- mycolate biosynthesis (25/205 steps found)
- superpathway of mycolate biosynthesis (26/239 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.3.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B5Z0 at UniProt or InterPro
Protein Sequence (267 amino acids)
>BWI76_RS18235 trehalose-phosphatase (Klebsiella michiganensis M5al) MADQIYVPPALTGNCAFFFDLDGTLAGIKPHPDQVVIPADVLQTLRQLVQQHNGAVALIS GRSMVELDELTRPYRLPLAGVHGAERRDINGKTHIVSLPDSLLKALSAELTAALDALPGC ELESKGMAFALHYRQAPEHQHAVLALAQAVVQRHPILALQPGKCVVEIKPRGVNKGEAIA AFMQEAPFRGRKPVFVGDDLTDEAGFSVVNQLSGVSVKVGGGETQARWRLPDVAAVHLWI SNIANHGQQPDALTDRRDGYESLSRSI