Protein Info for BWI76_RS18210 in Klebsiella michiganensis M5al

Annotation: arginine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 TIGR00456: arginine--tRNA ligase" amino acids 3 to 577 (575 residues), 711.2 bits, see alignment E=4.1e-218 PF03485: Arg_tRNA_synt_N" amino acids 7 to 87 (81 residues), 79.5 bits, see alignment E=3.5e-26 PF00750: tRNA-synt_1d" amino acids 96 to 446 (351 residues), 584.9 bits, see alignment E=7.7e-180 PF05746: DALR_1" amino acids 460 to 577 (118 residues), 123.9 bits, see alignment E=5.6e-40

Best Hits

Swiss-Prot: 95% identical to SYR_KLEP7: Arginine--tRNA ligase (argS) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_22915)

MetaCyc: 93% identical to arginine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Arginine--tRNA ligase. [EC: 6.1.1.19]

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B666 at UniProt or InterPro

Protein Sequence (577 amino acids)

>BWI76_RS18210 arginine--tRNA ligase (Klebsiella michiganensis M5al)
MNIQALLSEKVSQALIAAGASADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAE
QVLSHLDLSGIASKVEIAGPGFINIFLDPAFLAENVSSALKSERLGVAQPQAQTVVVDYS
APNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHVGDWGTQFGMLIAYLEKQQQEN
AGEMALADLEGFYREAKKHYDEDEAFAERARSYVVKLQGGDEYFREMWRKLVDITMSQNQ
LTYNRLNVTLTRDDVMGESLYNPMLPGIVADLKAQGLAVESEGATVVFLDEYKNKEGEPM
GVIIQKKDGGYLYTTTDIACAKYRYENLHADRVLYYIDSRQHQHLMQAWTIVRKAGYVPD
SVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLDEALERARRLVAEKNPDMPADELEKL
ANAVGIGAVKYADLSKNRTTDYIFDWDNMLAFEGNTAPYMQYAYTRVLSVFRKADIDEST
LAAAPVVITEDREAQLAARLLQFEETLTVVAREGTPHVMCSYLYDLAGLFSGFYEHCPIL
SAESEETRNSRLKLALLTAKTLKLGLDTLGIETVERM