Protein Info for BWI76_RS18195 in Klebsiella michiganensis M5al

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08003: Methyltransf_9" amino acids 7 to 322 (316 residues), 562.8 bits, see alignment E=5.2e-173 TIGR00452: tRNA (mo5U34)-methyltransferase" amino acids 7 to 320 (314 residues), 492.6 bits, see alignment E=1.8e-152 PF13489: Methyltransf_23" amino acids 113 to 270 (158 residues), 44.4 bits, see alignment E=4.7e-15 PF13847: Methyltransf_31" amino acids 123 to 229 (107 residues), 32.9 bits, see alignment E=1.4e-11 PF13649: Methyltransf_25" amino acids 126 to 220 (95 residues), 31.9 bits, see alignment E=5.4e-11 PF08241: Methyltransf_11" amino acids 127 to 224 (98 residues), 30.2 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 94% identical to CMOB_KLEP3: tRNA U34 carboxymethyltransferase (cmoB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 94% identity to kpu:KP1_3516)

MetaCyc: 85% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5U1 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BWI76_RS18195 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Klebsiella michiganensis M5al)
MIDFSNFYQLIAKSPLSHWLETLPAQVAAWQRDALHGKYREWERAVEFLPEFAPYRLDLL
HSVTAESETPLGEGQRLRIENLLKNLMPWRKGPFSLYGVNIDTEWRSDWKWERVLPHLSD
LTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLG
IEQLPALNAFDTVFSMGVLYHRRSPLDHLWQLKDQLVPGGELVLETLVVEGDENTVLVPG
DRYAQMRNVYFIPSAAALKQWLEKCGFVDVRIVDACVTSTDEQRRTEWMTTESLADFLDP
RDSSKTVEGYPAPLRAVIIASKPETQQSLAAKKNRSQG