Protein Info for BWI76_RS18160 in Klebsiella michiganensis M5al

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 236 (236 residues), 350.7 bits, see alignment E=2.3e-109 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 103.7 bits, see alignment E=6e-34 PF01709: Transcrip_reg" amino acids 82 to 235 (154 residues), 210.2 bits, see alignment E=1.5e-66

Best Hits

Swiss-Prot: 98% identical to Y1906_KLEP3: Probable transcriptional regulatory protein KPK_1906 (KPK_1906) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 94% identity to eok:G2583_2316)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B656 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS18160 YebC/PmpR family DNA-binding transcriptional regulator (Klebsiella michiganensis M5al)
MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALSNN
MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT
GGNLGTDGSVSYLFSKKGVISFEKGDEDAIMEAALEAGAEDVVTYDDGAIDVYTAWEEMG
AVRDALEAAGLKADAAEVSMIPSTKADMDAETAPKLLRLIDMLEDCDDVQEVYHNGEISD
EVAATL