Protein Info for BWI76_RS18105 in Klebsiella michiganensis M5al

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 9 to 489 (481 residues), 676.1 bits, E=1.4e-207
• PF00479: G6PD_N
  • amino acids 13 to 186 (174 residues), 193.5 bits, E=5.4e-61
• PF02781: G6PD_C
  • amino acids 188 to 488 (301 residues), 408.6 bits, E=1.3e-126

Best Hits

Swiss-Prot: 95% identical to G6PD_ECOLI: Glucose-6-phosphate 1-dehydrogenase (zwf) from Escherichia coli (strain K12)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 95% identity to ecd:ECDH10B_1993)

MetaCyc: 95% identical to NADP+-dependent glucose-6-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate dehydrogenase. [EC: 1.1.1.49]

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of glucose and xylose degradation (17/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• heterolactic fermentation (16/18 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See A0A285B5T1 at UniProt or InterPro

Protein Sequence (491 amino acids)

>BWI76_RS18105 glucose-6-phosphate dehydrogenase (Klebsiella michiganensis M5al)
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHPDTRIIGVGRADWDKDAYTK
VVREAMETFMKEKIDEGLWETLSGRLDFCNLDVNDTKAFTRLGKMLDQKERVTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLETSREINDRVGEFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDSRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLTADSIRDEKVKVLKSLRRIDRTNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSHTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KETWQELPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADRDSPKPYQAGTWGPVASVAMI
TRDGRSWNEFE