Protein Info for BWI76_RS18080 in Klebsiella michiganensis M5al

Annotation: protein YebE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details PF04391: DUF533" amino acids 33 to 216 (184 residues), 164.2 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: None (inferred from 77% identity to eae:EAE_22785)

Predicted SEED Role

"FIG004088: inner membrane protein YebE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5P6 at UniProt or InterPro

Protein Sequence (226 amino acids)

>BWI76_RS18080 protein YebE (Klebsiella michiganensis M5al)
MANWLNQLQSLLGQQGRSSSSDDQPSGNNLLLPGALGGLAGLLVASKSSRKLLAKYGTGA
LLVGGGAVAGSVLWNKYQQKMRASAQQTSADVAPAQAPSPAPAELDARSERLIMALVFAA
KSDGHIDDRERANTEEQLRAANVDVQGRVLIDRALAQPLDPQSLAHGISSEQEALEVYYI
SCAVIDIDHFMERSYLNALGEALKLPQDVREEIERDIQAQKQAITA