Protein Info for BWI76_RS18055 in Klebsiella michiganensis M5al

Annotation: copper resistance protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF05425: CopD" amino acids 186 to 282 (97 residues), 73.4 bits, see alignment E=9e-25

Best Hits

KEGG orthology group: None (inferred from 78% identity to eae:EAE_22760)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5S4 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BWI76_RS18055 copper resistance protein D (Klebsiella michiganensis M5al)
MLSAVYVSLRFIHFITLMVAFGCLLYGAWWAPAALRRLMMQRFYPLMRHLLLASALSALL
MLMAQGGLMGNGWPDVWQPAIWQAVAGTQFGGVWVWQILLAFVALAVVWLKPRRPGRLLL
VLFCAQLLLLAGVGHAAMNDGWLGIVQRTNHALHLFCVASWFGGLLPFIYCLRLAHGRWR
QAAICTMMRFSRYGHLAVAGAIASGAVNALLIQGGLISASPWGRMLLFKCALVAAMVAIA
LVNRYVLVPRMSAGGTRAEQLIVRTTQIEIALGALALFAVSLFATWEPF