Protein Info for BWI76_RS17990 in Klebsiella michiganensis M5al

Annotation: paraquat-inducible membrane protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 24 to 417 (394 residues), 602.2 bits, see alignment E=2.6e-185 PF04403: PqiA" amino acids 67 to 217 (151 residues), 123 bits, see alignment E=5.2e-40 amino acids 263 to 418 (156 residues), 143.7 bits, see alignment E=2.2e-46

Best Hits

Swiss-Prot: 77% identical to YEBS_ECO57: Intermembrane transport protein YebS (yebS) from Escherichia coli O157:H7

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 90% identity to kpe:KPK_1941)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5U2 at UniProt or InterPro

Protein Sequence (427 amino acids)

>BWI76_RS17990 paraquat-inducible membrane protein A (Klebsiella michiganensis M5al)
MPLKTPRITPAKKMIVYSVSAPVAHAHYQRCPQCDLLFRLPVLKKNQSAWCPRCNAKVRD
GRDWSLTRLGSMAIAMLLLMPFAWSEPLLRLHLLGVRIDANVLQGIWQMTGQGDPLTAAM
VLFCAVVAPVLLVVSIAYLWLGNVLGMNLRPILLMLERLKEWVMLDIYLVGIGVASIKVQ
DYAFLQPGIGLIAYIALTLLSILTLIHMNVEELWERFYPQRPALRPDNNLQVCLGCHYTG
HRDSRGRCRRCHTPLRHRRRQSLQKSWAALIASMVFLLPANLLPISIIYVNGARQDDTIL
SGIMSLASSNVAIAGVVFIASILVPFTKVIVLFTLLVSIQFKCEQGLRTRILLLRLITWI
GRWSMLDLFVIALTMSLINRDQLLAFTMGPAAVYFGAAVILTILAVEWLDSRLLWDAHES
GNARFAD