Protein Info for BWI76_RS17965 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 233 to 249 (17 residues), see Phobius details amino acids 269 to 295 (27 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 363 to 380 (18 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 412 (391 residues), 174 bits, see alignment E=4.2e-55 PF00083: Sugar_tr" amino acids 38 to 186 (149 residues), 23.8 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 80% identical to YEBQ_ECOLI: Uncharacterized transporter YebQ (yebQ) from Escherichia coli (strain K12)

KEGG orthology group: K08169, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 90% identity to kpe:KPK_1946)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B616 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BWI76_RS17965 MFS transporter (Klebsiella michiganensis M5al)
MDKKLSDGLPLPQRYGAILTIVLGLSMAVLDGAIANVALPTIASDLNASPASSIWIVNAY
QIAIVIALLPLSFLGDMVGYRHIYKIGLALFTFTSLACALSTSLEMLTLARVAQGLGGAA
LMSVNTALIRLIYPQRFLGRGMGINSFVVAVSSAAGPTIAAAILSMASWQWLFLINVPLG
IISLLLAIRYLPANAGRSKVTRFDLPSAIMNAITFGLLITALGGFAQGQSGELVAAEIVA
MLVVGFFFVRRQLRMPVPLLPIDLLRIPLFSLSICTSICSFCAQMLAMVSLPFFLQSMMG
RSEVETGLLLTPWPLATMVMAPLAGYLIEKVHAGLLGAIGLLVMACGLFGLALLPSAPTD
LDIIWRMALCGAGFGLFQSPNNHTIVSSAPAHRSGGASGMLGTARLLGQSTGAALVALLF
NLSGNSGTHTALMLAGILAVVAAAVSGLRVTQPRARL