Protein Info for BWI76_RS17950 in Klebsiella michiganensis M5al

Annotation: PhoP regulon feedback inhibition membrane protein MgrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 47 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13998: MgrB" amino acids 19 to 47 (29 residues), 60.5 bits, see alignment E=5.7e-21

Best Hits

Swiss-Prot: 98% identical to MGRB_KLEP3: PhoP/PhoQ regulator MgrB (mgrB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_22650)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (47 amino acids)

>BWI76_RS17950 PhoP regulon feedback inhibition membrane protein MgrB (Klebsiella michiganensis M5al)
MKKLRWVLLTVIIAGCLLLWTQMLNVMCDQDVQFFSGICTINKFIPW