Protein Info for BWI76_RS17875 in Klebsiella michiganensis M5al

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR00720: L-serine ammonia-lyase" amino acids 2 to 451 (450 residues), 756.4 bits, see alignment E=5.4e-232 PF03315: SDH_beta" amino acids 3 to 155 (153 residues), 201.2 bits, see alignment E=1.2e-63 PF03313: SDH_alpha" amino acids 184 to 448 (265 residues), 297.3 bits, see alignment E=1.2e-92

Best Hits

Swiss-Prot: 88% identical to SDHL_ECOLI: L-serine dehydratase 1 (sdaA) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 94% identity to kva:Kvar_1852)

MetaCyc: 88% identical to L-serine deaminase I (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5R5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BWI76_RS17875 L-serine ammonia-lyase (Klebsiella michiganensis M5al)
MISIFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLNEVTRLAVDVYGSLSLTGKGH
HTDIAIIMGLAGNQPDTVDIDAIPAFIRDVEERGRLLLAQGQHEVDFPKNDGMRFRSDNL
PLHENGMTIHAWSGEKEIYSKTYYSIGGGFIVDEEHFGKESASELAVPYPFKSAQEMLGY
CKQTGMSLSGMVMQNELALHSKKEIEDYFANIWQTMRACIDRGMNTEGVLPGPLRVPRRA
SALRRMLVASDKLSNDPMNVVDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYY
DHFIEPVSPDIYIRYFLASGAIGTLYKMNASISGAEVGCQGEVGVACSMAAAGLAEILGA
SPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINASRMAMRRTSEPRVS
LDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD