Protein Info for BWI76_RS17865 in Klebsiella michiganensis M5al

Annotation: aminodeoxychorismate synthase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF04715: Anth_synt_I_N" amino acids 22 to 151 (130 residues), 85.7 bits, see alignment E=3.6e-28 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 105 to 445 (341 residues), 443.5 bits, see alignment E=2.2e-137 PF00425: Chorismate_bind" amino acids 188 to 441 (254 residues), 295.3 bits, see alignment E=4.2e-92

Best Hits

Swiss-Prot: 90% identical to PABB_KLEAE: Aminodeoxychorismate synthase component 1 (pabB) from Klebsiella aerogenes

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 83% identity to kpe:KPK_1965)

MetaCyc: 76% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5T4 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BWI76_RS17865 aminodeoxychorismate synthase subunit I (Klebsiella michiganensis M5al)
MLSPAMLSLPWRPDAAEDYFSPLSSQPWAMLLHSGFAEHPHNRFDIVVAQPRATLVTRGN
MTVINDGETVSTSAADPLTLVHQQLARFNLQPQAHPQLPFLGGALGLFGYDLGRRFENLP
AQAEADIDLPDMAVGIYDWALIVDHQRREVSLFSYGDPQARLAWLEAQAEPAAAPFALTS
GWRSNMSRAEYGEKFRQVQAYLHSGDCYQVNLAQRFTASYRGDEWLAFRQLNRVNRAPFS
AFIRLQEGAILSLSPERFIQLRQGEIQTRPIKGTLPRLADPEQDALQAQKLANSAKDRAE
NLMIVDLMRNDIGRVAVPGSVRVPELFVVEPFPAVHHLVSTVTARLPAHLHAADLLRAAF
PGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTACRGRIYCS
AGGGIVADSEEAAEYQETFDKVNRILHQLES