Protein Info for BWI76_RS17830 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 122.5 bits, see alignment E=4.1e-39 PF08402: TOBE_2" amino acids 280 to 350 (71 residues), 39.8 bits, see alignment E=8.3e-14

Best Hits

Swiss-Prot: 57% identical to UGPC_SHISS: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Shigella sonnei (strain Ss046)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 98% identity to kva:Kvar_1861)

MetaCyc: 57% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5G4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>BWI76_RS17830 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MGSVVLNSVRKSYGDAHVIKDVSLTIPDGEFCVLVGPSGCGKSTLLRMIAGLEEISGGEV
HINERNVTEVEPKLRDIAMVFQSYALYPQMTVRENMGFALKMAKLPKAEINQKVNEAAAL
LGLEPLLERLPKDLSGGQRQRVAMGRAIVRKPQVFLFDEPLSNLDAKLRTQVRGEIRELH
RRLKTTSVYVTHDQIEAMTMGQMIVVLRDGRIEQAGTPLELYDRPANLFVAGFIGSPEIN
QLPGEVVLNGNATSLRLKDGSLLALPAGLRVTDGQQVVYAIRPEQVNVVHEARDDALAAK
VTAVENTGSDMQLFCDTGGGAFTSVFKQRLAVKEGDKIWLQPKLSGVHLFDAQSGQRIAC
REEV