Protein Info for BWI76_RS17815 in Klebsiella michiganensis M5al

Annotation: ATP-dependent helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF00270: DEAD" amino acids 32 to 82 (51 residues), 25.4 bits, see alignment 2.1e-09 PF06733: DEAD_2" amino acids 179 to 247 (69 residues), 22.6 bits, see alignment E=1.5e-08 PF13307: Helicase_C_2" amino acids 459 to 616 (158 residues), 144.2 bits, see alignment E=8.4e-46

Best Hits

Swiss-Prot: 92% identical to YOAA_ECOLI: Probable ATP-dependent DNA helicase YoaA (yoaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_22565)

MetaCyc: 92% identical to ATP-dependent DNA helicase YoaA (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"DinG family ATP-dependent helicase YoaA" in subsystem DNA repair, bacterial DinG and relatives

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5S7 at UniProt or InterPro

Protein Sequence (636 amino acids)

>BWI76_RS17815 ATP-dependent helicase (Klebsiella michiganensis M5al)
MIDDFAADGQLASAIAGFKPREPQRQMAFAVASAIEETRPLVVEAGTGTGKTYAYLAPAL
RANKKVIISTGSKALQDQLYSRDLPTVAKALKYTGKLALLKGRSNYLCLERLEQQALAGG
DLPVQTLSDVILLRSWSNQTVDGDISTCVSVAEDSQAWPLVTSTNDNCLGSDCPLYKDCF
VVKARKKAMDADVVVVNHHLFLADMVVKESGFAELIPEAEVMIFDEAHQLPDIASQYFGQ
SLSSRQLLDLAKDITIAYRTELKDTQQLQKCADRLAQSAQDFRLQLGEPGYRGNLRELLA
DHNIQRALLLLDDALELCYDVAKLSLGRSALLDAAFERATLYRGRLKRLKETSQPGFSYW
YECTSRTFTLALTPLTVADKFKEVMAQKSGSWIFTSATLSVNDDLHHFTDRLGIGEAQTL
LLPSPFDYAHQALLCVPRNLPLPNQPGAARHLAAMLKPLIEANDGRCFMLCTSHAMMRDL
AEQFRATMTLPVLLQGETSKGQLLQQFVSAGNALLVATSSFWEGVDVRGDALSLVIIDKL
PFTSPDDPLLKARMEDCRLRGGDPFDEVQLPDAVITLKQGVGRLIRDVTDRGVLVICDNR
LVMRPYGATFLASLPPAPRTRDIRRAVRFLAVPPAR