Protein Info for BWI76_RS17800 in Klebsiella michiganensis M5al

Annotation: long-chain-fatty-acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 40 to 430 (391 residues), 338.5 bits, E=4.8e-105
• PF13193: AMP-binding_C
  • amino acids 480 to 554 (75 residues), 65.8 bits, E=5.6e-22

Best Hits

Swiss-Prot: 94% identical to LCFA_ECOLI: Long-chain-fatty-acid--CoA ligase (fadD) from Escherichia coli (strain K12)

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 95% identity to kva:Kvar_1867)

MetaCyc: 93% identical to long-chain-fatty-acid--CoA ligase monomer (Escherichia coli BL21(DE3))
6.2.1.-; 6.2.1.-

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• oleate β-oxidation (32/35 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (8/10 steps found)
• fatty acid salvage (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phytol degradation (3/4 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• cinnamoyl-CoA biosynthesis (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• long chain fatty acid ester synthesis (engineered) (2/4 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• octane oxidation (2/5 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• pinosylvin metabolism (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (5/18 steps found)
• cutin biosynthesis (2/16 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

See A0A285B5Y2 at UniProt or InterPro

Protein Sequence (572 amino acids)

>BWI76_RS17800 long-chain-fatty-acid--CoA ligase (Klebsiella michiganensis M5al)
MTTNNYFRGDAVKKVWLNRYPADVPAEINPDRYQSLVELFEHAVRRYADQPAFINMGEVM
TYRKLEERSRAFAAYLQEGLGLQKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYT
PRELEHQLNDSGAAAIVIVSNFAHTLEKVVDKTQVKHVILTRMGDQLSPAKGTVVNFVVK
YIKRLVPKYHLPDAISFRSALQHGYRMQYIKPEIVPQDLAFLQYTGGTTGVAKGAMLTHR
NMLANLEQVNGTYGPLLHRGKELVVTALPLYHIFALTMNCLLFIELGGQNLLITNPRDIP
GLVKELAKYPFTAMTGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLT
GQYLLEGYGLTECAPLVSVNPHDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGEPGELCV
KGPQVMLGYWQRPDATAEIIKDGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNE
IEDVVMQHAGVQEVAAVGVPSGSSGEAVKIFVVKKDPTLTEEMLITFCRRQLTGYKVPKH
VEFRDELPKSNVGKILRRELRDEARAKVDNKA