Protein Info for BWI76_RS17790 in Klebsiella michiganensis M5al

Annotation: cell division topological specificity factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 TIGR01215: cell division topological specificity factor MinE" amino acids 1 to 83 (83 residues), 123 bits, see alignment E=2e-40 PF03776: MinE" amino acids 14 to 82 (69 residues), 86.8 bits, see alignment E=4e-29

Best Hits

Swiss-Prot: 100% identical to MINE_KLEP7: Cell division topological specificity factor (minE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 99% identity to eae:EAE_22540)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5D8 at UniProt or InterPro

Protein Sequence (89 amino acids)

>BWI76_RS17790 cell division topological specificity factor (Klebsiella michiganensis M5al)
MALLDFFLSRKKNTANIAKERLQIIVAERRRGDAEPHYLPQLRKDILEVICKYVQIDPEM
VSVQLEQRDGDISILELNVTLPETEESKS