Protein Info for BWI76_RS17735 in Klebsiella michiganensis M5al

Annotation: D-amino acid dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00070: Pyr_redox" amino acids 2 to 36 (35 residues), 24.1 bits, see alignment 1.5e-08 PF01266: DAO" amino acids 2 to 397 (396 residues), 282.6 bits, see alignment E=2.3e-87 PF00890: FAD_binding_2" amino acids 3 to 240 (238 residues), 20.9 bits, see alignment E=6.5e-08 PF02558: ApbA" amino acids 3 to 38 (36 residues), 24.5 bits, see alignment 6.4e-09 PF13450: NAD_binding_8" amino acids 5 to 36 (32 residues), 26.7 bits, see alignment (E = 1.9e-09)

Best Hits

Swiss-Prot: 94% identical to DADA_KLEP3: D-amino acid dehydrogenase (dadA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_22100)

MetaCyc: 89% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5K0 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BWI76_RS17735 D-amino acid dehydrogenase small subunit (Klebsiella michiganensis M5al)
MRVVILGSGVVGVASAWYLSQAGHEVTVIDRQPGPAEETSAANAGQISPGYAAPWAAPGV
PLKAIKWMFQRHAPLAIGLDGTPFQLKWMWQMLRNCDTRHYMENKGRMVRLAEYSRDCLK
ALRESTGIQYEGRQGGTLQLFRTDKQFENATRDIAVLQEAGVPYQLLEANRLLEVEPALA
EVSHKLTGGLRLPNDETGDCQLFTTRLARMAEQAGVTFRFNTPVDELLYEGDLISGVKCG
AEIIKADAYVMAFGSYSTAMLKGLVDIPVYPLKGYSLTIPIAEEDGAPVSTILDETYKIA
ITRFDRRIRVGGMAEIVGFNKELLQPRRETLEMVVRDLFPRGGHVEQATFWTGLRPMTPD
GTPVVGRTAYKNLWLNTGHGTLGWTMACGSGQLISDLISGRTPAIPYDDLAVARYGRGFT
PARAQHLHGVHN