Protein Info for BWI76_RS17715 in Klebsiella michiganensis M5al

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 43 to 168 (126 residues), 97.8 bits, E=1.6e-32

Best Hits

Swiss-Prot: 95% identical to EMTA_KLEP7: Endo-type membrane-bound lytic murein transglycosylase A (emtA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K08308, membrane-bound lytic murein transglycosylase E [EC: 3.2.1.-] (inferred from 93% identity to kva:Kvar_1884)

MetaCyc: 82% identical to lytic murein transglycosylase E (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase E (EC 3.2.1.-)" (EC 3.2.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• peptidoglycan recycling II (7/10 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

See A0A285B5R0 at UniProt or InterPro

Protein Sequence (203 amino acids)

>BWI76_RS17715 murein transglycosylase (Klebsiella michiganensis M5al)
MKLRWCVFLCVLLAGCSSKHDYRNPPWNPEVPVKRAMQWMPISEKAGAAWGVDPQLITAI
IAIESGGNPTVVSKSGAVGLMQLKPSTSGRDVYRRMGWSGDPSVSELKNPERNISMGAAY
LSILENGPLAGIKDPQVMRYAVVVSYANGAGALLRTFSSNRQDAIEEINDMDADDFFEHV
VKKHPAPQAPRYIWKLQKALDAM