Protein Info for BWI76_RS17690 in Klebsiella michiganensis M5al

Annotation: putative glycoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF16966: Porin_8" amino acids 98 to 463 (366 residues), 590.2 bits, see alignment E=7.1e-182

Best Hits

KEGG orthology group: None (inferred from 77% identity to spq:SPAB_03499)

Predicted SEED Role

"Putative glycoporin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5B9 at UniProt or InterPro

Protein Sequence (463 amino acids)

>BWI76_RS17690 putative glycoporin (Klebsiella michiganensis M5al)
MKVKYIALVISGVFSSGLLAATNNQSADIEKRLAQLEQRLMNAEQRAADAEAKIQTLTRQ
QAVAAKSAPTVKVQSAEPVAPGAEPTKLTLSGYGDIKFYGDVEFNMDGASSSGSLTSVKT
TANKDWAPGNNERWDINGRLLLGFDGMRKMDNGNFAGFSVQPLADLNGKMNLDDAVFFFG
QEKDWKVKVGRFEAYDMFPLNQDTFVEYSGNTANDLYSDGYGYIYMMKEGRGRSSSGGNF
LVSKTFDNWYFELNTLLEDGSTLFQDKQYHGTDLENEKNVAYLRPVVAWNSGRFSTAIAM
ESNVVNNAYGYHDAKGHWVDQSSRTGYGYTMTWNGQKTDPLDGVVTNLNLAWMDAEDETD
FTAGVNSLWRGFELGYIYAHNKIDRFNTANFVANCDDSCWIADPGKYDIHTIHASYLFPN
VMNMKNFNIYLGAYASWIESNPTSGDGQQDSRYGGRLRFKYFF