Protein Info for BWI76_RS17650 in Klebsiella michiganensis M5al

Annotation: putative fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 56 to 286 (231 residues), 110.5 bits, see alignment E=6.1e-36

Best Hits

KEGG orthology group: None (inferred from 75% identity to kpn:KPN_02298)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5U9 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BWI76_RS17650 putative fatty acid desaturase (Klebsiella michiganensis M5al)
MAKSRSVYLHPQQRERIHQFSRSWLWRSELPTWLLIVAVYGGWFASLAWWRELGIFPATL
LLIWFTAWYMSLQHELIHGHPTSRPWFNQLLGTLPLAVWYPYGLYRDSHLAHHNHQLLTQ
PVDDPESYYFTPQSWRRFAPWQRSLIHLRNTFLGRLLVAPLLDIAQTLTSALAAFRHRRV
NVIAMWLVHGLLLAALFAWMNHLGFSPLYFVLAISYPALALTKVRSFLEHRAADDPLARS
VINEAGLVWRVLFLNLNYHSVHHDLPGVPWYGLRKIYLFNQADYQRRNAGFVVRGYGEWL
RHFFARSVAVNAHPGFNQQGKADKDHE