Protein Info for BWI76_RS17640 in Klebsiella michiganensis M5al

Annotation: luciferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 8 to 430 (423 residues), 487.5 bits, see alignment E=1.6e-150 PF00296: Bac_luciferase" amino acids 22 to 385 (364 residues), 158.9 bits, see alignment E=9.9e-51

Best Hits

Swiss-Prot: 43% identical to YXEK_BACSU: Putative monooxygenase YxeK (yxeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 87% identity to kva:Kvar_1902)

MetaCyc: 43% identical to N-acetyl-S-(2-succino)-L-cysteine monooxygenase monomer (Bacillus subtilis subtilis 168)
1.14.13.M85 [EC: 1.14.13.M85]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5A9 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BWI76_RS17640 luciferase-like protein (Klebsiella michiganensis M5al)
MPNNPMILNLFFFNPQGDYRFSWRHPQAPEKEIFSLKYYVDLARKAEAATLDAIFVADHI
AIWDTVPSGLTHYANARLEPITLLSALAAVTEHIGLMGTASTSYNEPYNLARYFASLDFL
SNGRASWNIVTSWLEEEAANFGLDHLPQHGSRYQRAGEFIDVVTQLWDSWEDGAVRYDKA
SGLFADSSKVHHLDFAGEFFRVRGPLNVPRPPQGHPVLVQAGSSEAGKNLAAAWSDMHFV
FIKSIAEGLAYREEMNQRLRSHGRDPAHFKIIAGVLPVVVHSNAEKEERQRLNEQLMSDQ
MAIDLLSSYLRMDLSAYPVDQPLPPLPEEETFDGIRTALRLIRDYDPRLTILALGKLLLQ
SSDSWLLIGSAEEIASALTETWRAGAADGFNLMFPLLPGDFDRFVEQVVPILQRSGAMRD
RYPTGTLREKLGLPVVENRFARRDGKPQAS