Protein Info for BWI76_RS17625 in Klebsiella michiganensis M5al

Annotation: quaternary amine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 132 to 159 (28 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 58 to 199 (142 residues), 52.2 bits, see alignment E=3.4e-18

Best Hits

Swiss-Prot: 35% identical to OSMW_SALTY: Osmoprotectant import permease protein OsmW (osmW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 80% identity to kpe:KPK_2011)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5L5 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS17625 quaternary amine ABC transporter permease (Klebsiella michiganensis M5al)
MIDWLWILDNKIMIGELLWQHVQLVIVSLFFGTLFTGVLISLTLRWPATAQPLIYLCGIL
FTIPSLALFILLLPFTGLSLMTSIIGLTLYSLLILLRNVIAGIEKLPATVLESARALGYT
RWFRFVDIELHLLLPSLFAGLRIASVTLVGLVTVTALIGQGGLGQLLLAGFNQNFVTPIA
VSLALSVVLSLLLDSLIARVGYWLTPWAR