Protein Info for BWI76_RS17620 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 20 to 165 (146 residues), 116 bits, see alignment E=2.1e-37

Best Hits

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 81% identity to kpe:KPK_2012)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5F1 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BWI76_RS17620 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MIKLDNIRKTYPGSAHAAIRGLSLVINSGELCTFVGPSGCGKTTILRMINQLDVPDAGDV
YVQGVKLAAADIIQVRRQIGFVMQSAALFPHRTVAQNIATVPRLLGWSKKHIQARIDELV
DLMSLDRNVLPRYPHQLSGGQQGRVAIARALAADPPVLLMDEPFAAIDPVVRERLQDELL
LLQQRLRKTIVLVTHDINEAIRLGDRIAIFQEGGELAQFATPDHILSHPASDFVRRFIGP
EPNLQRLGRIQVGQLPRHDVPLIDESLSPIASPHPPVASPLRLVLDKKRRPLNWFDPVKR
RTLPVDAPLAAINTLRFAYSALLDAPGGVVVHVDADGEYQGSISHALLQNVLEGRVDLRR
YD