Protein Info for BWI76_RS17615 in Klebsiella michiganensis M5al

Annotation: RNA pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00849: PseudoU_synth_2" amino acids 25 to 177 (153 residues), 90.6 bits, see alignment E=6.2e-30

Best Hits

Swiss-Prot: 43% identical to RLUA_HAEDU: Ribosomal large subunit pseudouridine synthase A (rluA) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K06177, ribosomal large subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 81% identity to spe:Spro_3940)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase A (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5P0 at UniProt or InterPro

Protein Sequence (228 amino acids)

>BWI76_RS17615 RNA pseudouridine synthase (Klebsiella michiganensis M5al)
MSTIIDTFIAPPCHAEIDILYQDEHLLLIDKPAGLLSLSGKNPRNLDSVHYRLVQQFPGC
ALAHRLDFGTSGLMVIARNKVINAALCQQFSQRAVSKVYSALLCGHLADDEGTIDAPIAK
DPALFPLMTICPRRGKPARSGYRVVERLRYQDSVPVTRVQLTPETGRTHQLRIHCQQLGH
PILGCDLYGGLLLPGTEQAPRLMLHASELHFMHPVSGERIDAISPCGF