Protein Info for BWI76_RS17590 in Klebsiella michiganensis M5al

Annotation: 5-hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 26 to 136 (111 residues), 135.4 bits, E=5.3e-44
• PF00576: Transthyretin
  • amino acids 27 to 135 (109 residues), 119 bits, E=7.4e-39

Best Hits

Swiss-Prot: 58% identical to HIUH_ECOLI: 5-hydroxyisourate hydrolase (hiuH) from Escherichia coli (strain K12)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 77% identity to enc:ECL_00086)

MetaCyc: 58% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"Transthyretin family protein"

MetaCyc Pathways

• superpathway of purines degradation in plants (15/18 steps found)
• ureide biosynthesis (7/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• urate conversion to allantoin III (2/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

See A0A285B5A3 at UniProt or InterPro

Protein Sequence (136 amino acids)

>BWI76_RS17590 5-hydroxyisourate hydrolase (Klebsiella michiganensis M5al)
MKKLSSLILLSAISVAPAAFSAPVGTLSVHILNQQTGLPSSGVTVTLEKQQADKWTALAS
GVTDNDGRIKSLYPAEGDMQPGVYKVTFKTGDDFSKQKLATFFPEIPVLFTVTRTNEKLH
IPLLLSQYGYSTYKGS