Protein Info for BWI76_RS17555 in Klebsiella michiganensis M5al

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 23 to 435 (413 residues), 327.2 bits, see alignment E=1.5e-101 PF00860: Xan_ur_permease" amino acids 26 to 406 (381 residues), 301.3 bits, see alignment E=4.4e-94 TIGR03173: xanthine permease" amino acids 30 to 438 (409 residues), 459.2 bits, see alignment E=1.1e-141

Best Hits

Swiss-Prot: 43% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 90% identity to cro:ROD_33921)

MetaCyc: 43% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B588 at UniProt or InterPro

Protein Sequence (490 amino acids)

>BWI76_RS17555 permease (Klebsiella michiganensis M5al)
MKDIANSASRNGSSTAPVDEVLPVTQMILYGLQHVLVMYAGAVAVPLVVGNAVGLPPEHI
ILLISADLFICGAATIVQSLGVGKWLGCRLPLIQGCTFAALIPMVLIGKEYGIGGISGAV
IVSGIFILCCAPWISKLIRFFPKVVMGSIVTLIGMSIMPVAGGWIGGGSSEMSGFGAPFS
LLMAAITLVIILNIYTFASGVVKNTSVLIGLIIGTVLWSCFKPLDFSLVHATPWLHLPTL
MPFAKPEFHIIPVALLSMVMVVVMVETMSSMMATGDIVGKKVDAKMLRNGLNTCGIATTI
CGFFNLFPYAAFAQNVGLIGLTGVRSRFVVSVSGIILILMGVFSRMAALVVLIPKPILGG
AGIVMFGMVAVSGIRTLGQVNYRNNNNGMVVALTLGLGMMPVLVPNLFTQFPPMVQLFLH
SGITIGTLTAIVANLTLNGSVPLRVNHETPVPDPAPPSSAARNMAVRTVRMWLLLRKVQK
ERQPEEAQEG